Lineage for d1h9uc_ (1h9u C:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776988Protein Retinoid-X receptor beta (RXR-beta) [74792] (1 species)
  7. 776989Species Human (Homo sapiens) [TaxId:9606] [74793] (2 PDB entries)
    Uniprot P28702 298-528
  8. 776992Domain d1h9uc_: 1h9u C: [70925]

Details for d1h9uc_

PDB Entry: 1h9u (more details), 2.7 Å

PDB Description: the structure of the human retinoid-x-receptor beta ligand binding domain in complex with the specific synthetic agonist lg100268
PDB Compounds: (C:) retinoid x receptor, beta

SCOP Domain Sequences for d1h9uc_:

Sequence, based on SEQRES records: (download)

>d1h9uc_ a.123.1.1 (C:) Retinoid-X receptor beta (RXR-beta) {Human (Homo sapiens) [TaxId: 9606]}
mpvdrileaelaveqksdqgvegpggtggsgsspndpvtnicqaadkqlftlvewakrip
hfsslplddqvillragwnelliasfshrsidvrdgillatglhvhrnsahsagvgaifd
rvltelvskmrdmrmdktelgclraiilfnpdakglsnpsevevlrekvyasletyckqk
ypeqqgrfaklllrlpalrsiglkclehlfffkligdtpidtfl

Sequence, based on observed residues (ATOM records): (download)

>d1h9uc_ a.123.1.1 (C:) Retinoid-X receptor beta (RXR-beta) {Human (Homo sapiens) [TaxId: 9606]}
mpvdrileaelavpvtnicqaadkqlftlvewakriphfsslplddqvillragwnelli
asfshrsidvrdgillatglhvhrnsahsagvgaifdrvltelvskmrdmrmdktelgcl
raiilfnpdakglsnpsevevlrekvyasletyckqkypeqqgrfaklllrlpalrsigl
kclehlfffkligdtpidtfl

SCOP Domain Coordinates for d1h9uc_:

Click to download the PDB-style file with coordinates for d1h9uc_.
(The format of our PDB-style files is described here.)

Timeline for d1h9uc_: