Lineage for d1h9ub_ (1h9u B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009304Protein Retinoid-X receptor beta (RXR-beta) [74792] (1 species)
  7. 2009305Species Human (Homo sapiens) [TaxId:9606] [74793] (2 PDB entries)
    Uniprot P28702 298-528
  8. 2009307Domain d1h9ub_: 1h9u B: [70924]
    complexed with cl, lg2, ni

Details for d1h9ub_

PDB Entry: 1h9u (more details), 2.7 Å

PDB Description: the structure of the human retinoid-x-receptor beta ligand binding domain in complex with the specific synthetic agonist lg100268
PDB Compounds: (B:) retinoid x receptor, beta

SCOPe Domain Sequences for d1h9ub_:

Sequence, based on SEQRES records: (download)

>d1h9ub_ a.123.1.1 (B:) Retinoid-X receptor beta (RXR-beta) {Human (Homo sapiens) [TaxId: 9606]}
mpvdrileaelaveqksdqgvegpggtggsgsspndpvtnicqaadkqlftlvewakrip
hfsslplddqvillragwnelliasfshrsidvrdgillatglhvhrnsahsagvgaifd
rvltelvskmrdmrmdktelgclraiilfnpdakglsnpsevevlrekvyasletyckqk
ypeqqgrfaklllrlpalrsiglkclehlfffkligdtpidtfl

Sequence, based on observed residues (ATOM records): (download)

>d1h9ub_ a.123.1.1 (B:) Retinoid-X receptor beta (RXR-beta) {Human (Homo sapiens) [TaxId: 9606]}
mpvdrileaelavpvtnicqaadkqlftlvewakriphfsslplddqvillragwnelli
asfshrsidvrdgillatglhvhrnsahsagvgaifdrvltelvskmrdmrmdktelgcl
raiilfnpdakglsnpsevevlrekvyasletyckqkypeqqgrfaklllrlpalrsigl
kclehlfffkligdtpidtfl

SCOPe Domain Coordinates for d1h9ub_:

Click to download the PDB-style file with coordinates for d1h9ub_.
(The format of our PDB-style files is described here.)

Timeline for d1h9ub_: