Lineage for d1h8ka_ (1h8k A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372425Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 372467Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 372468Family b.34.2.1: SH3-domain [50045] (33 proteins)
  6. 372490Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 372491Species Chicken (Gallus gallus) [TaxId:9031] [50059] (17 PDB entries)
  8. 372502Domain d1h8ka_: 1h8k A: [70915]
    mutant

Details for d1h8ka_

PDB Entry: 1h8k (more details), 2.7 Å

PDB Description: a-spectrin sh3 domain a11v, v23l, m25v, v53i, v58l mutant

SCOP Domain Sequences for d1h8ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ka_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus)}
kelvlvlydyqeksprevtvkkgdiltllnstnkdwwkvevddrqgfipaaylkkld

SCOP Domain Coordinates for d1h8ka_:

Click to download the PDB-style file with coordinates for d1h8ka_.
(The format of our PDB-style files is described here.)

Timeline for d1h8ka_: