Class a: All alpha proteins [46456] (290 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.5: Tubulin chaperone cofactor A [46988] (1 family) automatically mapped to Pfam PF02970 |
Family a.7.5.1: Tubulin chaperone cofactor A [46989] (1 protein) the C-terminal helix is shorter that the other two helices this is a repeat family; one repeat unit is 1qsd A: found in domain |
Protein Tubulin chaperone cofactor A [46990] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [74701] (1 PDB entry) |
Domain d1h7ca_: 1h7c A: [70914] complexed with acy, so4 |
PDB Entry: 1h7c (more details), 1.8 Å
SCOPe Domain Sequences for d1h7ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h7ca_ a.7.5.1 (A:) Tubulin chaperone cofactor A {Human (Homo sapiens) [TaxId: 9606]} prvrqikiktgvvrrlvkervmyekeakqqeekiekmraedgenydikkqaeilqesrmm ipdcqrrleaayldlqrilenekdleeaeeykearlvldsvkl
Timeline for d1h7ca_: