Lineage for d1h7ca_ (1h7c A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696680Superfamily a.7.5: Tubulin chaperone cofactor A [46988] (1 family) (S)
    automatically mapped to Pfam PF02970
  5. 2696681Family a.7.5.1: Tubulin chaperone cofactor A [46989] (1 protein)
    the C-terminal helix is shorter that the other two helices
    this is a repeat family; one repeat unit is 1qsd A: found in domain
  6. 2696682Protein Tubulin chaperone cofactor A [46990] (2 species)
  7. 2696686Species Human (Homo sapiens) [TaxId:9606] [74701] (1 PDB entry)
  8. 2696687Domain d1h7ca_: 1h7c A: [70914]
    complexed with acy, so4

Details for d1h7ca_

PDB Entry: 1h7c (more details), 1.8 Å

PDB Description: human tubulin chaperone cofactor a
PDB Compounds: (A:) tubulin-specific chaperone a

SCOPe Domain Sequences for d1h7ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7ca_ a.7.5.1 (A:) Tubulin chaperone cofactor A {Human (Homo sapiens) [TaxId: 9606]}
prvrqikiktgvvrrlvkervmyekeakqqeekiekmraedgenydikkqaeilqesrmm
ipdcqrrleaayldlqrilenekdleeaeeykearlvldsvkl

SCOPe Domain Coordinates for d1h7ca_:

Click to download the PDB-style file with coordinates for d1h7ca_.
(The format of our PDB-style files is described here.)

Timeline for d1h7ca_: