Lineage for d1h6za2 (1h6z A:406-537)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176798Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 176799Superfamily c.8.1: Phosphohistidine domain [52009] (2 families) (S)
  5. 176800Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein)
  6. 176801Protein Pyruvate phosphate dikinase, central domain [52011] (2 species)
  7. 176809Species Trypanosoma brucei [TaxId:5691] [75134] (1 PDB entry)
  8. 176810Domain d1h6za2: 1h6z A:406-537 [70907]
    Other proteins in same PDB: d1h6za1, d1h6za3

Details for d1h6za2

PDB Entry: 1h6z (more details), 3 Å

PDB Description: 3.0 a resolution crystal structure of glycosomal pyruvate phosphate dikinase from trypanosoma brucei

SCOP Domain Sequences for d1h6za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6za2 c.8.1.1 (A:406-537) Pyruvate phosphate dikinase, central domain {Trypanosoma brucei}
pnlepgaekankpigrglaaspgaavgqvvfdaesakewsgrgkkvimvrletspedlag
mdaacgiltarggmtshaavvargmgkccvsgcgdmvirgksfklngsvfregdyitidg
skgliyagklkl

SCOP Domain Coordinates for d1h6za2:

Click to download the PDB-style file with coordinates for d1h6za2.
(The format of our PDB-style files is described here.)

Timeline for d1h6za2: