SCOPe 2.06: Domain d1h6fb_: 1h6f B:

Lineage for d1h6fb_ (1h6f B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.4: T-box [81316] (3 proteins)
   automatically mapped to Pfam PF00907

6. Protein T-box protein 3, tbx3 [74868] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74869] (1 PDB entry)

8. Domain d1h6fb_: 1h6f B: [70902]
   complexed with mg

Details for d1h6fb_

PDB Entry: 1h6f, 1.7 Å

PDB Description: human tbx3, a transcription factor responsible for ulnar-mammary syndrome, bound to a palindromic dna site

PDB Compounds: (B:) t-box transcription factor tbx3

SCOPe Domain Sequences for d1h6fb_:

Sequence; same for both SEQRES and ATOM records:

>d1h6fb_ b.2.5.4 (B:) T-box protein 3, tbx3 {Human (Homo sapiens) [TaxId: 9606]}
kddpkvhleakelwdqfhkrgtemvitksgrrmfppfkvrcsgldkkakyillmdiiaad
dcrykfhnsrwmvagkadpempkrmyihpdspatgeqwmskvvtfhklkltnnisdkhgf
tilnsmhkyqprfhivrandilklpystfrtylfpetefiavtayqndkitqlkidnnpf
akgfrd

Timeline for d1h6fb_:

• d1h6fb_ first appeared in SCOP 1.61
  
• d1h6fb_ appears in SCOPe 2.05
  
• d1h6fb_ appears in SCOPe 2.07
  
• d1h6fb_ appears in the current release, SCOPe 2.08