Class b: All beta proteins [48724] (178 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins) molybdopterine enzyme |
Protein Dimethylsulfoxide reductase (DMSO reductase) [50697] (2 species) |
Species Rhodobacter capsulatus [TaxId:1061] [50699] (10 PDB entries) |
Domain d1h5nc1: 1h5n C:626-781 [70896] Other proteins in same PDB: d1h5na2, d1h5nc2 complexed with 6mo, pgd, so4 |
PDB Entry: 1h5n (more details), 2 Å
SCOPe Domain Sequences for d1h5nc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h5nc1 b.52.2.2 (C:626-781) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus [TaxId: 1061]} erldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpddaaargiadgd vvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygdvnvlsadigt sklaqgncgqtvlaevekytgpavtltgfvapkaae
Timeline for d1h5nc1: