SCOP 1.61: Domain d1h5nc1: 1h5n C:626-781

Lineage for d1h5nc1 (1h5n C:626-781)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)

4. Superfamily b.52.2: ADC-like [50692] (3 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (6 proteins)

6. Protein Dimethylsulfoxide reductase (DMSO reductase) [50697] (2 species)

7. Species Rhodobacter capsulatus [TaxId:1061] [50699] (10 PDB entries)

8. Domain d1h5nc1: 1h5n C:626-781 [70896]
   Other proteins in same PDB: d1h5na2, d1h5nc2

Details for d1h5nc1

PDB Entry: 1h5n, 2 Å

PDB Description: dmso reductase modified by the presence of dms and air

SCOP Domain Sequences for d1h5nc1:

Sequence; same for both SEQRES and ATOM records:

>d1h5nc1 b.52.2.2 (C:626-781) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus}
erldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpddaaargiadgd
vvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygdvnvlsadigt
sklaqgncgqtvlaevekytgpavtltgfvapkaae

Timeline for d1h5nc1:

• d1h5nc1 is new in SCOP 1.61
  
• d1h5nc1 appears in SCOP 1.63
  
• d1h5nc1 appears in the current release, SCOPe 2.08