Lineage for d1h5na1 (1h5n A:626-781)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 169434Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
  4. 169448Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 169454Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (6 proteins)
  6. 169463Protein Dimethylsulfoxide reductase (DMSO reductase) [50697] (2 species)
  7. 169464Species Rhodobacter capsulatus [TaxId:1061] [50699] (10 PDB entries)
  8. 169471Domain d1h5na1: 1h5n A:626-781 [70894]
    Other proteins in same PDB: d1h5na2, d1h5nc2

Details for d1h5na1

PDB Entry: 1h5n (more details), 2 Å

PDB Description: dmso reductase modified by the presence of dms and air

SCOP Domain Sequences for d1h5na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h5na1 b.52.2.2 (A:626-781) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus}
erldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpddaaargiadgd
vvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygdvnvlsadigt
sklaqgncgqtvlaevekytgpavtltgfvapkaae

SCOP Domain Coordinates for d1h5na1:

Click to download the PDB-style file with coordinates for d1h5na1.
(The format of our PDB-style files is described here.)

Timeline for d1h5na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h5na2