![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
![]() | Superfamily b.52.2: ADC-like [50692] (4 families) ![]() |
![]() | Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins) molybdopterine enzyme |
![]() | Protein Dimethylsulfoxide reductase (DMSO reductase) [50697] (2 species) |
![]() | Species Rhodobacter capsulatus [TaxId:1061] [50699] (10 PDB entries) |
![]() | Domain d1h5na1: 1h5n A:626-781 [70894] Other proteins in same PDB: d1h5na2, d1h5nc2 complexed with 6mo, pgd, so4 |
PDB Entry: 1h5n (more details), 2 Å
SCOPe Domain Sequences for d1h5na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h5na1 b.52.2.2 (A:626-781) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus [TaxId: 1061]} erldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpddaaargiadgd vvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygdvnvlsadigt sklaqgncgqtvlaevekytgpavtltgfvapkaae
Timeline for d1h5na1: