Lineage for d1h5ma_ (1h5m A:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) 
Family a.93.1.1: CCP-like [48114] (6 proteins) Protein Plant peroxidase [48125] (6 species) 
Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (21 PDB entries) 
Domain d1h5ma_: 1h5m A: [70893]
Details for d1h5ma_
PDB Entry: 1h5m (more details), 1.57 Å
PDB Description: x-ray induced reduction of horseradish peroxidase c1a compound iii (0-100% dose)
SCOP Domain Sequences for d1h5ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h5ma_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana)}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvns
SCOP Domain Coordinates for d1h5ma_:
Click to download the PDB-style file with coordinates for d1h5ma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h5ma_:
- d1h5ma_ is new in SCOP 1.61
- d1h5ma_ appears in SCOP 1.63
- d1h5ma_ appears in the current release, SCOPe 2.08
View in 3D