Lineage for d1h5ca_ (1h5c A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445911Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 445912Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 445913Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 446058Protein Plant peroxidase [48125] (6 species)
  7. 446061Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (28 PDB entries)
  8. 446067Domain d1h5ca_: 1h5c A: [70883]

Details for d1h5ca_

PDB Entry: 1h5c (more details), 1.62 Å

PDB Description: x-ray induced reduction of horseradish peroxidase c1a compound iii (100-200% dose)

SCOP Domain Sequences for d1h5ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h5ca_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana)}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvns

SCOP Domain Coordinates for d1h5ca_:

Click to download the PDB-style file with coordinates for d1h5ca_.
(The format of our PDB-style files is described here.)

Timeline for d1h5ca_: