Lineage for d1h59a_ (1h59 A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888633Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 888634Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 888635Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 888855Protein Insulin-like growth factor [57002] (1 species)
  7. 888856Species Human (Homo sapiens) [TaxId:9606] [57003] (19 PDB entries)
    Uniprot P05019 49-110
  8. 888859Domain d1h59a_: 1h59 A: [70880]
    Other proteins in same PDB: d1h59b_
    complex with IGFBP-5

Details for d1h59a_

PDB Entry: 1h59 (more details), 2.1 Å

PDB Description: complex of igfbp-5 with igf-i
PDB Compounds: (A:) insulin-like growth factor ia

SCOP Domain Sequences for d1h59a_:

Sequence, based on SEQRES records: (download)

>d1h59a_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyc
apl

Sequence, based on observed residues (ATOM records): (download)

>d1h59a_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkptgytgivdeccfrscdlrrlemycapl

SCOP Domain Coordinates for d1h59a_:

Click to download the PDB-style file with coordinates for d1h59a_.
(The format of our PDB-style files is described here.)

Timeline for d1h59a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1h59b_