Lineage for d1h57a_ (1h57 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741311Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1741312Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1741313Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1741565Protein Plant peroxidase [48125] (6 species)
  7. 1741568Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (29 PDB entries)
  8. 1741588Domain d1h57a_: 1h57 A: [70878]
    complexed with act, ca, hem, oxy, peo

Details for d1h57a_

PDB Entry: 1h57 (more details), 1.6 Å

PDB Description: Structure of horseradish peroxidase C1A compound III
PDB Compounds: (A:) peroxidase c1a

SCOPe Domain Sequences for d1h57a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h57a_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvns

SCOPe Domain Coordinates for d1h57a_:

Click to download the PDB-style file with coordinates for d1h57a_.
(The format of our PDB-style files is described here.)

Timeline for d1h57a_: