Lineage for d1h57a_ (1h57 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358328Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 358329Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 358330Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 358468Protein Plant peroxidase [48125] (6 species)
  7. 358471Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (28 PDB entries)
  8. 358481Domain d1h57a_: 1h57 A: [70878]
    complexed with act, ca, hem, peo

Details for d1h57a_

PDB Entry: 1h57 (more details), 1.6 Å

PDB Description: Structure of horseradish peroxidase C1A compound III

SCOP Domain Sequences for d1h57a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h57a_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana)}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvns

SCOP Domain Coordinates for d1h57a_:

Click to download the PDB-style file with coordinates for d1h57a_.
(The format of our PDB-style files is described here.)

Timeline for d1h57a_: