![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
![]() | Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (3 families) ![]() the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
![]() | Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (3 proteins) duplication: consists of two domains of this fold |
![]() | Protein Sulfurtransferase [52830] (1 species) |
![]() | Species Azotobacter vinelandii [TaxId:354] [52831] (3 PDB entries) |
![]() | Domain d1h4mx2: 1h4m X:136-271 [70876] complexed with edo |
PDB Entry: 1h4m (more details), 2.1 Å
SCOP Domain Sequences for d1h4mx2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4mx2 c.46.1.2 (X:136-271) Sulfurtransferase {Azotobacter vinelandii} ggpvalslhdeptasrdyllgrlgaadlaiwdarspqeyrgekvlaakgghipgavnfew taamdpsralrirtdiagrleelgitpdkeivthcqthhrsgltyliakalgyprvkgya gswgewgnhpdtpvel
Timeline for d1h4mx2: