SCOP 1.73: Domain d1h4le_: 1h4l E:

Lineage for d1h4le_ (1h4l E:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (4 proteins)

6. Protein CDK5 activator 1 (NCK5a, p25) [74739] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74740] (4 PDB entries)

8. Domain d1h4le_: 1h4l E: [70874]
   Other proteins in same PDB: d1h4la_, d1h4lb_

Details for d1h4le_

PDB Entry: 1h4l, 2.65 Å

PDB Description: structure and regulation of the cdk5-p25(nck5a) complex

PDB Compounds: (E:) cyclin-dependent kinase 5 activator

SCOP Domain Sequences for d1h4le_:

Sequence; same for both SEQRES and ATOM records:

>d1h4le_ a.74.1.1 (E:) CDK5 activator 1 (NCK5a, p25) {Human (Homo sapiens) [TaxId: 9606]}
stsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflym
lcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsvin
lmsskmlqinadphyftqvfsdlknes

Timeline for d1h4le_:

• d1h4le_ first appeared in SCOP 1.61
  
• d1h4le_ appears in SCOP 1.71
  
• d1h4le_ appears in SCOP 1.75
  
• d1h4le_ appears in the current release, SCOPe 2.08