Lineage for d1h4ld_ (1h4l D:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445218Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 445219Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 445220Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 445221Protein CDK5 activator 1 (NCK5a, p25) [74739] (1 species)
  7. 445222Species Human (Homo sapiens) [TaxId:9606] [74740] (1 PDB entry)
  8. 445223Domain d1h4ld_: 1h4l D: [70873]
    Other proteins in same PDB: d1h4la_, d1h4lb_

Details for d1h4ld_

PDB Entry: 1h4l (more details), 2.65 Å

PDB Description: structure and regulation of the cdk5-p25(nck5a) complex

SCOP Domain Sequences for d1h4ld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4ld_ a.74.1.1 (D:) CDK5 activator 1 (NCK5a, p25) {Human (Homo sapiens)}
stsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflym
lcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsvin
lmsskmlqinadphyftqvfsdlknes

SCOP Domain Coordinates for d1h4ld_:

Click to download the PDB-style file with coordinates for d1h4ld_.
(The format of our PDB-style files is described here.)

Timeline for d1h4ld_: