Lineage for d1h4la_ (1h4l A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 197199Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 197200Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 197201Family d.144.1.1: Serine/threonin kinases [56113] (18 proteins)
  6. 197245Protein Cyclin-dependent PK (CDK, different isozymes) [56114] (1 species)
  7. 197246Species Human (Homo sapiens) [TaxId:9606] [56115] (38 PDB entries)
  8. 197282Domain d1h4la_: 1h4l A: [70871]
    Other proteins in same PDB: d1h4ld_, d1h4le_

Details for d1h4la_

PDB Entry: 1h4l (more details), 2.65 Å

PDB Description: structure and regulation of the cdk5-p25(nck5a) complex

SCOP Domain Sequences for d1h4la_:

Sequence, based on SEQRES records: (download)

>d1h4la_ d.144.1.1 (A:) Cyclin-dependent PK (CDK, different isozymes) {Human (Homo sapiens)}
qkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkhk
nivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrn
vlhrdlkpqnllinrngelkladfglarafgipvrcysaevvtlwyrppdvlfgaklyst
sidmwsagcifaelanaarplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypm
ypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfs

Sequence, based on observed residues (ATOM records): (download)

>d1h4la_ d.144.1.1 (A:) Cyclin-dependent PK (CDK, different isozymes) {Human (Homo sapiens)}
qkyeklekiygtvfkaknretheivalkrvrldgvpssalreicllkelkhknivrlhdv
lhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrnvlhrdlkp
qnllinrngelkladfglarafgipvrcysaevvtlwyrppdvlfgaklystsidmwsag
cifaelanaarplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypmypattslv
nvvpklnatgrdllqnllkcnpvqrisaeealqhpyfs

SCOP Domain Coordinates for d1h4la_:

Click to download the PDB-style file with coordinates for d1h4la_.
(The format of our PDB-style files is described here.)

Timeline for d1h4la_: