Lineage for d1h4kx2 (1h4k X:136-271)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (3 families) 
Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (2 proteins) 
Protein Sulfurtransferase [52830] (1 species) Species Azotobacter vinelandii [TaxId:354] [52831] (3 PDB entries) 
Domain d1h4kx2: 1h4k X:136-271 [70870]
Details for d1h4kx2
PDB Entry: 1h4k (more details), 2.05 Å
PDB Description: sulfurtransferase from azotobacter vinelandii in complex with hypophosphite
SCOP Domain Sequences for d1h4kx2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4kx2 c.46.1.2 (X:136-271) Sulfurtransferase {Azotobacter vinelandii}
ggpvalslhdeptasrdyllgrlgaadlaiwdarspqeyrgekvlaakgghipgavnfew
taamdpsralrirtdiagrleelgitpdkeivthcqthhrsgltyliakalgyprvkgya
gswgewgnhpdtpvel
SCOP Domain Coordinates for d1h4kx2:
Click to download the PDB-style file with coordinates for d1h4kx2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h4kx2:
- d1h4kx2 is new in SCOP 1.61
- d1h4kx2 appears in SCOP 1.63
- d1h4kx2 appears in the current release, SCOPe 2.08
View in 3D
