SCOPe 2.06: Domain d1h4kx1: 1h4k X:1-135

Lineage for d1h4kx1 (1h4k X:1-135)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein Sulfurtransferase [52830] (2 species)

7. Species Azotobacter vinelandii [TaxId:354] [52831] (3 PDB entries)

8. Domain d1h4kx1: 1h4k X:1-135 [70869]
   complexed with edo, po2, so4

Details for d1h4kx1

PDB Entry: 1h4k, 2.05 Å

PDB Description: sulfurtransferase from azotobacter vinelandii in complex with hypophosphite

PDB Compounds: (X:) sulfurtransferase

SCOPe Domain Sequences for d1h4kx1:

Sequence; same for both SEQRES and ATOM records:

>d1h4kx1 c.46.1.2 (X:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]}
mddfaslplviepadlqarlsapelilvdltsaaryaeghipgarfvdpkrtqlgqppap
glqppreqleslfgelghrpeavyvvyddegggwagrfiwlldvigqqryhylnggltaw
laedrplsrelpapa

Timeline for d1h4kx1:

• d1h4kx1 first appeared in SCOP 1.61
  
• d1h4kx1 appears in SCOPe 2.05
  
• d1h4kx1 appears in SCOPe 2.07
  
• d1h4kx1 appears in the current release, SCOPe 2.08