![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
![]() | Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (3 families) ![]() the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
![]() | Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (3 proteins) duplication: consists of two domains of this fold |
![]() | Protein Sulfurtransferase [52830] (1 species) |
![]() | Species Azotobacter vinelandii [TaxId:354] [52831] (3 PDB entries) |
![]() | Domain d1h4kx1: 1h4k X:1-135 [70869] |
PDB Entry: 1h4k (more details), 2.05 Å
SCOP Domain Sequences for d1h4kx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4kx1 c.46.1.2 (X:1-135) Sulfurtransferase {Azotobacter vinelandii} mddfaslplviepadlqarlsapelilvdltsaaryaeghipgarfvdpkrtqlgqppap glqppreqleslfgelghrpeavyvvyddegggwagrfiwlldvigqqryhylnggltaw laedrplsrelpapa
Timeline for d1h4kx1: