Lineage for d1h4kx1 (1h4k X:1-135)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876007Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2876008Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) (S)
    Pfam PF00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 2876043Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2876069Protein Sulfurtransferase [52830] (2 species)
  7. 2876070Species Azotobacter vinelandii [TaxId:354] [52831] (3 PDB entries)
  8. 2876073Domain d1h4kx1: 1h4k X:1-135 [70869]
    complexed with edo, po2, so4

Details for d1h4kx1

PDB Entry: 1h4k (more details), 2.05 Å

PDB Description: sulfurtransferase from azotobacter vinelandii in complex with hypophosphite
PDB Compounds: (X:) sulfurtransferase

SCOPe Domain Sequences for d1h4kx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4kx1 c.46.1.2 (X:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]}
mddfaslplviepadlqarlsapelilvdltsaaryaeghipgarfvdpkrtqlgqppap
glqppreqleslfgelghrpeavyvvyddegggwagrfiwlldvigqqryhylnggltaw
laedrplsrelpapa

SCOPe Domain Coordinates for d1h4kx1:

Click to download the PDB-style file with coordinates for d1h4kx1.
(The format of our PDB-style files is described here.)

Timeline for d1h4kx1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h4kx2