SCOP 1.73: Domain d1h4ha_: 1h4h A:

Lineage for d1h4ha_ (1h4h A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (16 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus agaradhaerens [TaxId:76935] [49982] (4 PDB entries)

8. Domain d1h4ha_: 1h4h A: [70865]

Details for d1h4ha_

PDB Entry: 1h4h, 1.9 Å

PDB Description: oligosaccharide-binding to family 11 xylanases: both covalent intermediate and mutant-product complexes display 2,5b conformations at the active-centre

PDB Compounds: (A:) xylanase

SCOP Domain Sequences for d1h4ha_:

Sequence; same for both SEQRES and ATOM records:

>d1h4ha_ b.29.1.11 (A:) Xylanase II {Bacillus agaradhaerens [TaxId: 76935]}
eivtdnsignhdgydyefwkdsggsgtmilnhggtfsaqwnnvnnilfrkgkkfnetqth
qqvgnmsinyganfqpngnaylcvygwtvdplvayyivdswgnwrppgatpkgtitvdgg
tydiyetlrvnqpsikgiatfkqywsvrrskrtsgtisvsnhfrawenlgmnmgkmyeva
ltvegyqssgsanvysntlringnpls

Timeline for d1h4ha_:

• d1h4ha_ first appeared in SCOP 1.61
  
• d1h4ha_ appears in SCOP 1.71
  
• d1h4ha_ appears in SCOP 1.75
  
• d1h4ha_ appears in the current release, SCOPe 2.08