SCOP 1.75: Domain d1h2ja_: 1h2j A:

Lineage for d1h2ja_ (1h2j A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.3: beta-glycanases [51487] (26 proteins)
   consist of a number of sequence families

6. Protein Endoglucanase Cel5a [51499] (4 species)

7. Species Bacillus agaradhaerens [TaxId:76935] [51500] (20 PDB entries)
   Uniprot O85465 30-329

8. Domain d1h2ja_: 1h2j A: [70862]
   complexed with dcb, gol, so4

Details for d1h2ja_

PDB Entry: 1h2j, 1.15 Å

PDB Description: endoglucanase cel5a in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-cellobioside at 1.15 a resolution

PDB Compounds: (A:) endoglucanase 5a

SCOP Domain Sequences for d1h2ja_:

Sequence; same for both SEQRES and ATOM records:

>d1h2ja_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires

Timeline for d1h2ja_:

• d1h2ja_ first appeared in SCOP 1.61
  
• d1h2ja_ appears in SCOP 1.73
  
• d1h2ja_ appears in SCOPe 2.01
  
• d1h2ja_ appears in the current release, SCOPe 2.08