![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins) |
![]() | Protein Hypothetical protein TM1643 [75487] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [75488] (2 PDB entries) |
![]() | Domain d1h2ha3: 1h2h A:109-211 [70861] Other proteins in same PDB: d1h2ha4 complexed with nad |
PDB Entry: 1h2h (more details), 2.6 Å
SCOPe Domain Sequences for d1h2ha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h2ha3 d.81.1.3 (A:109-211) Hypothetical protein TM1643 {Thermotoga maritima [TaxId: 2336]} aiggldvlssikdfvknvrietikppkslgldlkgktvvfegsveeasklfprninvast iglivgfekvkvtivadpamdhnihivrissaignyefkieni
Timeline for d1h2ha3: