Lineage for d1h2ha3 (1h2h A:109-211)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1659008Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1659009Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1659397Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 1659474Protein Hypothetical protein TM1643 [75487] (1 species)
  7. 1659475Species Thermotoga maritima [TaxId:2336] [75488] (2 PDB entries)
  8. 1659477Domain d1h2ha3: 1h2h A:109-211 [70861]
    Other proteins in same PDB: d1h2ha4
    complexed with nad

Details for d1h2ha3

PDB Entry: 1h2h (more details), 2.6 Å

PDB Description: crystal structure of tm1643
PDB Compounds: (A:) hypothetical protein tm1643

SCOPe Domain Sequences for d1h2ha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2ha3 d.81.1.3 (A:109-211) Hypothetical protein TM1643 {Thermotoga maritima [TaxId: 2336]}
aiggldvlssikdfvknvrietikppkslgldlkgktvvfegsveeasklfprninvast
iglivgfekvkvtivadpamdhnihivrissaignyefkieni

SCOPe Domain Coordinates for d1h2ha3:

Click to download the PDB-style file with coordinates for d1h2ha3.
(The format of our PDB-style files is described here.)

Timeline for d1h2ha3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h2ha4