SCOPe 2.08: Domain d1h2ha3: 1h2h A:109-211

Lineage for d1h2ha3 (1h2h A:109-211)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)

6. Protein Hypothetical protein TM1643 [75487] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [75488] (2 PDB entries)

8. Domain d1h2ha3: 1h2h A:109-211 [70861]
   Other proteins in same PDB: d1h2ha4
   complexed with nad

Details for d1h2ha3

PDB Entry: 1h2h, 2.6 Å

PDB Description: crystal structure of tm1643

PDB Compounds: (A:) hypothetical protein tm1643

SCOPe Domain Sequences for d1h2ha3:

Sequence; same for both SEQRES and ATOM records:

>d1h2ha3 d.81.1.3 (A:109-211) Hypothetical protein TM1643 {Thermotoga maritima [TaxId: 2336]}
aiggldvlssikdfvknvrietikppkslgldlkgktvvfegsveeasklfprninvast
iglivgfekvkvtivadpamdhnihivrissaignyefkieni

Timeline for d1h2ha3:

• d1h2ha3 first appeared in SCOP 1.61
  
• d1h2ha3 appears in SCOPe 2.07