Lineage for d1h2ha1 (1h2h A:1-108)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) 
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 proteins) 
Protein Hypothetical protein TM1643 [75108] (1 species) Species Thermotoga maritima [TaxId:243274] [75109] (2 PDB entries) 
Domain d1h2ha1: 1h2h A:1-108 [70859]
Other proteins in same PDB: d1h2ha3
Details for d1h2ha1
PDB Entry: 1h2h (more details), 2.6 Å
PDB Description: crystal structure of tm1643
SCOP Domain Sequences for d1h2ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h2ha1 c.2.1.3 (A:1-108) Hypothetical protein TM1643 {Thermotoga maritima}
mtvliigmgnigkklvelgnfekiyaydriskdipgvvrldefqvpsdvstvvecaspea
vkeyslqilknpvnyiiistsafadevfrerffselknsparvffpsg
SCOP Domain Coordinates for d1h2ha1:
Click to download the PDB-style file with coordinates for d1h2ha1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h2ha1:
- d1h2ha1 is new in SCOP 1.61
- d1h2ha1 last appears in SCOP 1.63
View in 3D
