![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 proteins) |
![]() | Protein Hypothetical protein TM1643 [75108] (1 species) |
![]() | Species Thermotoga maritima [TaxId:243274] [75109] (2 PDB entries) |
![]() | Domain d1h2ha1: 1h2h A:1-108 [70859] Other proteins in same PDB: d1h2ha3 |
PDB Entry: 1h2h (more details), 2.6 Å
SCOP Domain Sequences for d1h2ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h2ha1 c.2.1.3 (A:1-108) Hypothetical protein TM1643 {Thermotoga maritima} mtvliigmgnigkklvelgnfekiyaydriskdipgvvrldefqvpsdvstvvecaspea vkeyslqilknpvnyiiistsafadevfrerffselknsparvffpsg
Timeline for d1h2ha1: