Lineage for d1h2fa_ (1h2f A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1863193Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 1863194Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 1863195Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 1863200Protein Broad specificity phosphatase PhoE (YhfR) [69539] (1 species)
  7. 1863201Species Bacillus stearothermophilus [TaxId:1422] [69540] (3 PDB entries)
  8. 1863203Domain d1h2fa_: 1h2f A: [70858]
    complexed with po4, va3

Details for d1h2fa_

PDB Entry: 1h2f (more details), 2 Å

PDB Description: bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate
PDB Compounds: (A:) phosphatase

SCOPe Domain Sequences for d1h2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2fa_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]}
attlyltrhgetkwnverrmqgwqdspltekgrqdamrlgkrleavelaaiytstsgral
etaeivrggrlipiyqderlreihlgdwegkthdeirqmdpiafdhfwqaphlyapqrge
rfcdvqqraleavqsivdrhegetvlivthgvvlktlmaafkdtpldhlwsppymygtsv
tiievdggtfhvavegdvshieevkev

SCOPe Domain Coordinates for d1h2fa_:

Click to download the PDB-style file with coordinates for d1h2fa_.
(The format of our PDB-style files is described here.)

Timeline for d1h2fa_: