![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
![]() | Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) ![]() |
![]() | Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (2 proteins) |
![]() | Protein Broad specificity phosphatase PhoE (YhfR) [69539] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [69540] (3 PDB entries) |
![]() | Domain d1h2ea_: 1h2e A: [70857] complexed with edo, po4 |
PDB Entry: 1h2e (more details), 1.69 Å
SCOP Domain Sequences for d1h2ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus} attlyltrhgetkwnverrmqgwqdspltekgrqdamrlgkrleavelaaiytstsgral etaeivrggrlipiyqderlreihlgdwegkthdeirqmdpiafdhfwqaphlyapqrge rfcdvqqraleavqsivdrhegetvlivthgvvlktlmaafkdtpldhlwsppymygtsv tiievdggtfhvavegdvshieevkev
Timeline for d1h2ea_: