Lineage for d1h1ld_ (1h1l D:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 186038Fold c.92: Chelatase-like [53799] (2 superfamilies)
  4. 186054Superfamily c.92.2: "Helical backbone" metal receptor [53807] (3 families) (S)
  5. 186071Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (1 protein)
  6. 186072Protein Nitrogenase iron-molybdenum protein, alpha and beta chains [53817] (3 species)
  7. 186101Species Klebsiella pneumoniae [TaxId:573] [53820] (4 PDB entries)
  8. 186117Domain d1h1ld_: 1h1l D: [70854]

Details for d1h1ld_

PDB Entry: 1h1l (more details), 1.9 Å

PDB Description: nitrogenase mo-fe protein from klebsiella pneumoniae, nifv mutant

SCOP Domain Sequences for d1h1ld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1ld_ c.92.2.3 (D:) Nitrogenase iron-molybdenum protein, alpha and beta chains {Klebsiella pneumoniae}
sqtidkinscyplfeqdeyqelfrnkrqleeahdaqrvqevfawtttaeyealnfrreal
tvdpakacqplgavlcslgfantlpyvhgsqgcvayfrtyfnrhfkepiacvsdsmteda
avfggnnnmnlglqnasalykpeiiavsttcmaevigddlqafianakkdgfvdssiavp
hahtpsfigshvtgwdnmfegfaktftadyqgqpgklpklnlvtgfetylgnfrvlkrmm
eqmavpcsllsdpsevldtpadghyrmysggttqqemkeapdaidtlllqpwqllkskkv
vqemwnqpatevaiplglaatdellmtvsqlsgkpiadaltlergrlvdmmldshtwlhg
kkfglygdpdfvmgltrfllelgceptvilshnankrwqkamnkmldaspygrdsevfin
cdlwhfrslmftrqpdfmignsygkfiqrdtlakgkafevplirlgfplfdrhhlhrqtt
wgyegamnivttlvnavlekldsdtsqlgktdysfdlvr

SCOP Domain Coordinates for d1h1ld_:

Click to download the PDB-style file with coordinates for d1h1ld_.
(The format of our PDB-style files is described here.)

Timeline for d1h1ld_: