Lineage for d1h1lc_ (1h1l C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143391Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 protein domains)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 2143392Protein Nitrogenase iron-molybdenum protein, alpha chain [81402] (3 species)
  7. 2143428Species Klebsiella pneumoniae [TaxId:573] [81400] (4 PDB entries)
  8. 2143436Domain d1h1lc_: 1h1l C: [70853]
    Other proteins in same PDB: d1h1lb_, d1h1ld_
    complexed with cfm, cit, cl, clf, mg; mutant

Details for d1h1lc_

PDB Entry: 1h1l (more details), 1.9 Å

PDB Description: nitrogenase mo-fe protein from klebsiella pneumoniae, nifv mutant
PDB Compounds: (C:) nitrogenase molybdenum iron protein alpha chain

SCOPe Domain Sequences for d1h1lc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1lc_ c.92.2.3 (C:) Nitrogenase iron-molybdenum protein, alpha chain {Klebsiella pneumoniae [TaxId: 573]}
tnatgernlaliqevlevfpetarkerrkhmmvsdpkmksvgkciisnrksqpgvmtvrg
cayagskgvvfgpikdmahishgpvgcgqysragrrnyytgvsgvdsfgtlnftsdfqer
divfggdkklsklieemellfpltkgitiqsecpvgligddisavanasskaldkpvipv
rcegfrgvsqslghhiandvvrdwilnnregqpfettpydvaiigdyniggdawasrill
eemglrvvaqwsgdgtlvementpfvklnlvhcyrsmnyiarhmeekhqipwmeynffgp
tkiaeslrkiadqfddtiranaeaviaryegqmaaiiakyrprlegrkvllymgglrprh
vigayedlgmeiiaagyefahnddydrtlpdlkegtllfddassyeleafvkalkpdlig
sgikekyifqkmgvpfrqmhswdysgpyhgydgfaifardmdmtlnnpawneltapwl

SCOPe Domain Coordinates for d1h1lc_:

Click to download the PDB-style file with coordinates for d1h1lc_.
(The format of our PDB-style files is described here.)

Timeline for d1h1lc_: