Lineage for d1h1la_ (1h1l A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 321573Fold c.92: Chelatase-like [53799] (2 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 321596Superfamily c.92.2: "Helical backbone" metal receptor [53807] (3 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 321621Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (2 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the interchain arrangment of domains 1 is similar to the intrachain arrangement of domains 2 and 3
  6. 321622Protein Nitrogenase iron-molybdenum protein, alpha chain [81402] (3 species)
  7. 321652Species Klebsiella pneumoniae [TaxId:573] [81400] (4 PDB entries)
  8. 321659Domain d1h1la_: 1h1l A: [70851]
    Other proteins in same PDB: d1h1lb_, d1h1ld_

Details for d1h1la_

PDB Entry: 1h1l (more details), 1.9 Å

PDB Description: nitrogenase mo-fe protein from klebsiella pneumoniae, nifv mutant

SCOP Domain Sequences for d1h1la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1la_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha chain {Klebsiella pneumoniae}
tnatgernlaliqevlevfpetarkerrkhmmvsdpkmksvgkciisnrksqpgvmtvrg
cayagskgvvfgpikdmahishgpvgcgqysragrrnyytgvsgvdsfgtlnftsdfqer
divfggdkklsklieemellfpltkgitiqsecpvgligddisavanasskaldkpvipv
rcegfrgvsqslghhiandvvrdwilnnregqpfettpydvaiigdyniggdawasrill
eemglrvvaqwsgdgtlvementpfvklnlvhcyrsmnyiarhmeekhqipwmeynffgp
tkiaeslrkiadqfddtiranaeaviaryegqmaaiiakyrprlegrkvllymgglrprh
vigayedlgmeiiaagyefahnddydrtlpdlkegtllfddassyeleafvkalkpdlig
sgikekyifqkmgvpfrqmhswdysgpyhgydgfaifardmdmtlnnpawneltapwl

SCOP Domain Coordinates for d1h1la_:

Click to download the PDB-style file with coordinates for d1h1la_.
(The format of our PDB-style files is described here.)

Timeline for d1h1la_: