![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) ![]() |
![]() | Family d.92.1.13: Leukotriene A4 hydrolase catalytic domain [64338] (1 protein) adopts thermolysin-like fold |
![]() | Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64340] (2 PDB entries) |
![]() | Domain d1h19a3: 1h19 A:209-460 [70849] Other proteins in same PDB: d1h19a1, d1h19a2 complexed with acy, imd, yb, zn; mutant |
PDB Entry: 1h19 (more details), 2.1 Å
SCOP Domain Sequences for d1h19a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h19a3 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens)} lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg gmqnpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl yspglppikpny
Timeline for d1h19a3: