Lineage for d1h19a1 (1h19 A:461-610)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216993Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 216994Superfamily a.118.1: ARM repeat [48371] (12 families) (S)
  5. 217112Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein)
    this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain
  6. 217113Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species)
  7. 217114Species Human (Homo sapiens) [TaxId:9606] [63610] (2 PDB entries)
  8. 217116Domain d1h19a1: 1h19 A:461-610 [70847]
    Other proteins in same PDB: d1h19a2, d1h19a3
    complexed with acy, imd, yb, zn; mutant

Details for d1h19a1

PDB Entry: 1h19 (more details), 2.1 Å

PDB Description: structure of [e271q]leukotriene a4 hydrolase

SCOP Domain Sequences for d1h19a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h19a1 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens)}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkvd

SCOP Domain Coordinates for d1h19a1:

Click to download the PDB-style file with coordinates for d1h19a1.
(The format of our PDB-style files is described here.)

Timeline for d1h19a1: