Lineage for d1h0na_ (1h0n A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353826Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 353827Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 354154Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins)
  6. 354256Protein Ribonucleotide reductase R2 [47257] (6 species)
  7. 354321Species Mouse (Mus musculus) [TaxId:10090] [47260] (3 PDB entries)
  8. 354324Domain d1h0na_: 1h0n A: [70844]
    complexed with co

Details for d1h0na_

PDB Entry: 1h0n (more details), 2.4 Å

PDB Description: cobalt substitution of mouse r2 ribonucleotide reductase to model the reactive diferrous state

SCOP Domain Sequences for d1h0na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0na_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus musculus)}
npsvedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhwealkpde
rhfishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysllidty
ikdpkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasi
fwlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavrieqef
ltealpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpfdfme

SCOP Domain Coordinates for d1h0na_:

Click to download the PDB-style file with coordinates for d1h0na_.
(The format of our PDB-style files is described here.)

Timeline for d1h0na_: