![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (2 families) ![]() contains dimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins) |
![]() | Protein Ribonucleotide reductase R2 [47257] (6 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [47260] (3 PDB entries) |
![]() | Domain d1h0na_: 1h0n A: [70844] complexed with co |
PDB Entry: 1h0n (more details), 2.4 Å
SCOP Domain Sequences for d1h0na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h0na_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus musculus)} npsvedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhwealkpde rhfishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysllidty ikdpkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasi fwlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavrieqef ltealpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpfdfme
Timeline for d1h0na_: