SCOP 1.65: Domain d1h0na_: 1h0n A:

Lineage for d1h0na_ (1h0n A:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (2 families)
   contains dimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (6 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47260] (3 PDB entries)

8. Domain d1h0na_: 1h0n A: [70844]
   complexed with co

Details for d1h0na_

PDB Entry: 1h0n, 2.4 Å

PDB Description: cobalt substitution of mouse r2 ribonucleotide reductase to model the reactive diferrous state

SCOP Domain Sequences for d1h0na_:

Sequence; same for both SEQRES and ATOM records:

>d1h0na_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus musculus)}
npsvedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhwealkpde
rhfishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysllidty
ikdpkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasi
fwlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavrieqef
ltealpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpfdfme

Timeline for d1h0na_:

• d1h0na_ first appeared in SCOP 1.61
  
• d1h0na_ appears in SCOP 1.63
  
• d1h0na_ appears in SCOP 1.67
  
• d1h0na_ appears in the current release, SCOPe 2.08