Lineage for d1h0ib2 (1h0i B:3-291,B:380-446)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 385175Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 385202Protein Chitinase B, catalytic domain [51546] (1 species)
  7. 385203Species Serratia marcescens [TaxId:615] [51547] (14 PDB entries)
  8. 385221Domain d1h0ib2: 1h0i B:3-291,B:380-446 [70842]
    Other proteins in same PDB: d1h0ia1, d1h0ia3, d1h0ib1, d1h0ib3
    complexed with gol, mea, rgi, so4

Details for d1h0ib2

PDB Entry: 1h0i (more details), 2 Å

PDB Description: complex of a chitinase with the natural product cyclopentapeptide argifin from gliocladium

SCOP Domain Sequences for d1h0ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0ib2 c.1.8.5 (B:3-291,B:380-446) Chitinase B, catalytic domain {Serratia marcescens}
trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrtk
faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfXddaesfkyka
kyikqqqlggvmfwhlgqdnrngdllaaldryfnaadyddsqldmgtglrytgvgpg

SCOP Domain Coordinates for d1h0ib2:

Click to download the PDB-style file with coordinates for d1h0ib2.
(The format of our PDB-style files is described here.)

Timeline for d1h0ib2: