Lineage for d1h0ia3 (1h0i A:292-379)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941865Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2941866Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 2941925Protein Chitinase B [54560] (1 species)
  7. 2941926Species Serratia marcescens [TaxId:615] [54561] (18 PDB entries)
  8. 2941957Domain d1h0ia3: 1h0i A:292-379 [70840]
    Other proteins in same PDB: d1h0ia1, d1h0ia2, d1h0ib1, d1h0ib2
    complexed with gol, so4

Details for d1h0ia3

PDB Entry: 1h0i (more details), 2 Å

PDB Description: complex of a chitinase with the natural product cyclopentapeptide argifin from gliocladium
PDB Compounds: (A:) chitinase b

SCOPe Domain Sequences for d1h0ia3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0ia3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens [TaxId: 615]}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

SCOPe Domain Coordinates for d1h0ia3:

Click to download the PDB-style file with coordinates for d1h0ia3.
(The format of our PDB-style files is described here.)

Timeline for d1h0ia3: