Lineage for d1h0gb3 (1h0g B:292-379)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199823Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1200057Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 1200058Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 1200117Protein Chitinase B [54560] (1 species)
  7. 1200118Species Serratia marcescens [TaxId:615] [54561] (14 PDB entries)
  8. 1200140Domain d1h0gb3: 1h0g B:292-379 [70837]
    Other proteins in same PDB: d1h0ga1, d1h0ga2, d1h0gb1, d1h0gb2
    complexed with gol

Details for d1h0gb3

PDB Entry: 1h0g (more details), 2 Å

PDB Description: complex of a chitinase with the natural product cyclopentapeptide argadin from clonostachys
PDB Compounds: (B:) chitinase b

SCOPe Domain Sequences for d1h0gb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0gb3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens [TaxId: 615]}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

SCOPe Domain Coordinates for d1h0gb3:

Click to download the PDB-style file with coordinates for d1h0gb3.
(The format of our PDB-style files is described here.)

Timeline for d1h0gb3: