| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
| Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
| Protein Chitinase B [54560] (1 species) |
| Species Serratia marcescens [TaxId:615] [54561] (18 PDB entries) |
| Domain d1h0gb3: 1h0g B:292-379 [70837] Other proteins in same PDB: d1h0ga1, d1h0ga2, d1h0gb1, d1h0gb2 complexed with gol |
PDB Entry: 1h0g (more details), 2 Å
SCOPe Domain Sequences for d1h0gb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h0gb3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens [TaxId: 615]}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty
Timeline for d1h0gb3: