Lineage for d1h02b_ (1h02 B:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061256Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 1061257Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 1061258Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 1061478Protein Insulin-like growth factor [57002] (1 species)
  7. 1061479Species Human (Homo sapiens) [TaxId:9606] [57003] (19 PDB entries)
    Uniprot P05019 49-110
  8. 1061485Domain d1h02b_: 1h02 B: [70831]
    complexed with c15

Details for d1h02b_

PDB Entry: 1h02 (more details), 2 Å

PDB Description: human insulin-like growth factor; srs daresbury data
PDB Compounds: (B:) insulin-like growth factor I

SCOPe Domain Sequences for d1h02b_:

Sequence, based on SEQRES records: (download)

>d1h02b_ g.1.1.1 (B:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
etlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyca
plkpak

Sequence, based on observed residues (ATOM records): (download)

>d1h02b_ g.1.1.1 (B:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
etlcgaelvdalqfvcgdrgfyfnkptgygsssapqtgivdeccfrscdlrrlemycapl
kpak

SCOPe Domain Coordinates for d1h02b_:

Click to download the PDB-style file with coordinates for d1h02b_.
(The format of our PDB-style files is described here.)

Timeline for d1h02b_: