Lineage for d1gzzb_ (1gzz B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634416Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 2634417Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 2634418Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 2634641Protein Insulin-like growth factor [57002] (1 species)
  7. 2634642Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries)
    Uniprot P05019 49-110
  8. 2634649Domain d1gzzb_: 1gzz B: [70830]
    complexed with c15

Details for d1gzzb_

PDB Entry: 1gzz (more details), 2.3 Å

PDB Description: human insulin-like growth factor; hamburg data
PDB Compounds: (B:) insulin-like growth factor I

SCOPe Domain Sequences for d1gzzb_:

Sequence, based on SEQRES records: (download)

>d1gzzb_ g.1.1.1 (B:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
caplkp

Sequence, based on observed residues (ATOM records): (download)

>d1gzzb_ g.1.1.1 (B:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
gpetlcgaelvdalqfvcgdrgfyfnkptgyapqtgivdeccfrscdlrrlemycaplkp

SCOPe Domain Coordinates for d1gzzb_:

Click to download the PDB-style file with coordinates for d1gzzb_.
(The format of our PDB-style files is described here.)

Timeline for d1gzzb_: