Lineage for d1gzyb_ (1gzy B:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 746752Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 746753Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 746754Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 746974Protein Insulin-like growth factor [57002] (1 species)
  7. 746975Species Human (Homo sapiens) [TaxId:9606] [57003] (18 PDB entries)
  8. 746984Domain d1gzyb_: 1gzy B: [70829]
    complexed with c15

Details for d1gzyb_

PDB Entry: 1gzy (more details), 2.54 Å

PDB Description: human insulin-like growth factor; in-house data
PDB Compounds: (B:) insulin-like growth factor I

SCOP Domain Sequences for d1gzyb_:

Sequence, based on SEQRES records: (download)

>d1gzyb_ g.1.1.1 (B:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
etlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyca
plkp

Sequence, based on observed residues (ATOM records): (download)

>d1gzyb_ g.1.1.1 (B:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
etlcgaelvdalqfvcgdrgfyfnkptgypqtgivdeccfrscdlrrlemycaplkp

SCOP Domain Coordinates for d1gzyb_:

Click to download the PDB-style file with coordinates for d1gzyb_.
(The format of our PDB-style files is described here.)

Timeline for d1gzyb_: