Lineage for d1gzua_ (1gzu A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105663Family c.26.1.3: Adenylyltransferase [52397] (6 protein domains)
  6. 2105692Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species)
  7. 2105724Species Human (Homo sapiens) [TaxId:9606] [75163] (6 PDB entries)
  8. 2105744Domain d1gzua_: 1gzu A: [70822]
    complexed with nmn

Details for d1gzua_

PDB Entry: 1gzu (more details), 2.9 Å

PDB Description: crystal structure of human nicotinamide mononucleotide adenylyltransferase in complex with nmn
PDB Compounds: (A:) nicotinamide mononucleotide adenylyl transferase

SCOPe Domain Sequences for d1gzua_:

Sequence, based on SEQRES records: (download)

>d1gzua_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens) [TaxId: 9606]}
ktevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipayh
rvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdcdhqqnsptlerpgr
krkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlwkseditqivanyglic
vtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirralrrgqsirylvpdlvq
eyiekhnlyssesedrnagvilaplq

Sequence, based on observed residues (ATOM records): (download)

>d1gzua_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens) [TaxId: 9606]}
ktevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipayh
rvimaelatknskwvevdtweslqkewketlkvlrhhqekleaavpkvkllcgadllesf
avpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandiss
tkirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplq

SCOPe Domain Coordinates for d1gzua_:

Click to download the PDB-style file with coordinates for d1gzua_.
(The format of our PDB-style files is described here.)

Timeline for d1gzua_: