Lineage for d1gzrb_ (1gzr B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029609Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 3029610Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 3029611Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 3029834Protein Insulin-like growth factor [57002] (1 species)
  7. 3029835Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries)
    Uniprot P05019 49-110
  8. 3029840Domain d1gzrb_: 1gzr B: [70821]
    complexed with c15

Details for d1gzrb_

PDB Entry: 1gzr (more details), 2 Å

PDB Description: human insulin-like growth factor; esrf data
PDB Compounds: (B:) insulin-like growth factor I

SCOPe Domain Sequences for d1gzrb_:

Sequence, based on SEQRES records: (download)

>d1gzrb_ g.1.1.1 (B:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
etlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyca
plkp

Sequence, based on observed residues (ATOM records): (download)

>d1gzrb_ g.1.1.1 (B:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
etlcgaelvdalqfvcgdrgfyfnkptgygssspqtgivdeccfrscdlrrlemycaplk
p

SCOPe Domain Coordinates for d1gzrb_:

Click to download the PDB-style file with coordinates for d1gzrb_.
(The format of our PDB-style files is described here.)

Timeline for d1gzrb_: