Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein CD1, alpha-1 and alpha-2 domains [54456] (4 species) Class I MHC-related |
Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (3 PDB entries) |
Domain d1gzqa2: 1gzq A:3-183 [70819] Other proteins in same PDB: d1gzqa1, d1gzqb_ complexed with d12, no3, pii, twt |
PDB Entry: 1gzq (more details), 2.26 Å
SCOP Domain Sequences for d1gzqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gzqa2 d.19.1.1 (A:3-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]} afqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdke vaeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggld flsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlq r
Timeline for d1gzqa2: