Lineage for d1gzqa2 (1gzq A:3-183)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190296Protein CD1, alpha-1 and alpha-2 domains [54456] (2 species)
  7. 190297Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (2 PDB entries)
  8. 190298Domain d1gzqa2: 1gzq A:3-183 [70819]
    Other proteins in same PDB: d1gzqa1, d1gzqb1

Details for d1gzqa2

PDB Entry: 1gzq (more details), 2.26 Å

PDB Description: cd1b in complex with phophatidylinositol

SCOP Domain Sequences for d1gzqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gzqa2 d.19.1.1 (A:3-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b}
afqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdke
vaeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggld
flsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlq
r

SCOP Domain Coordinates for d1gzqa2:

Click to download the PDB-style file with coordinates for d1gzqa2.
(The format of our PDB-style files is described here.)

Timeline for d1gzqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gzqa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1gzqb1