Lineage for d1gzqa1 (1gzq A:184-280)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364585Protein CD1, alpha-3 domain [88615] (3 species)
  7. 364589Species Human (Homo sapiens), CD1b [TaxId:9606] [88617] (3 PDB entries)
  8. 364590Domain d1gzqa1: 1gzq A:184-280 [70818]
    Other proteins in same PDB: d1gzqa2, d1gzqb_
    complexed with d12, no3, pii, twt

Details for d1gzqa1

PDB Entry: 1gzq (more details), 2.26 Å

PDB Description: cd1b in complex with phophatidylinositol

SCOP Domain Sequences for d1gzqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gzqa1 b.1.1.2 (A:184-280) CD1, alpha-3 domain {Human (Homo sapiens), CD1b}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw
ylratldvadgeaaglscrvkhsslegqdiilywgpg

SCOP Domain Coordinates for d1gzqa1:

Click to download the PDB-style file with coordinates for d1gzqa1.
(The format of our PDB-style files is described here.)

Timeline for d1gzqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gzqa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1gzqb_