Lineage for d1gzqa1 (1gzq A:184-280)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 158800Protein CD1, beta2-microglobulin and alpha-3 domain [49130] (2 species)
  7. 158801Species Human (Homo sapiens), CD1b [TaxId:9606] [74838] (2 PDB entries)
  8. 158802Domain d1gzqa1: 1gzq A:184-280 [70818]
    Other proteins in same PDB: d1gzqa2

Details for d1gzqa1

PDB Entry: 1gzq (more details), 2.26 Å

PDB Description: cd1b in complex with phophatidylinositol

SCOP Domain Sequences for d1gzqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gzqa1 b.1.1.2 (A:184-280) CD1, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), CD1b}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw
ylratldvadgeaaglscrvkhsslegqdiilywgpg

SCOP Domain Coordinates for d1gzqa1:

Click to download the PDB-style file with coordinates for d1gzqa1.
(The format of our PDB-style files is described here.)

Timeline for d1gzqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gzqa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1gzqb1